Lineage for d3etja1 (3etj A:277-355)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810849Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 810850Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 810899Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)
  7. 810900Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)
  8. 810901Domain d3etja1: 3etj A:277-355 [158204]
    Other proteins in same PDB: d3etja2, d3etja3, d3etjb2, d3etjb3
    automatically matched to d1b6ra1
    complexed with adp, cl, mg, pi; mutant

Details for d3etja1

PDB Entry: 3etj (more details), 1.6 Å

PDB Description: crystal structure e. coli purk in complex with mg, adp, and pi
PDB Compounds: (A:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOP Domain Sequences for d3etja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

SCOP Domain Coordinates for d3etja1:

Click to download the PDB-style file with coordinates for d3etja1.
(The format of our PDB-style files is described here.)

Timeline for d3etja1: