Lineage for d3ethb2 (3eth B:1-78)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2861873Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2862039Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain [52446] (1 species)
  7. 2862040Species Escherichia coli [TaxId:562] [52447] (4 PDB entries)
  8. 2862044Domain d3ethb2: 3eth B:1-78 [158202]
    Other proteins in same PDB: d3etha1, d3etha3, d3ethb1, d3ethb3
    automated match to d1b6ra2
    complexed with atp, mg

    fragment; missing more than one-third of the common structure and/or sequence

Details for d3ethb2

PDB Entry: 3eth (more details), 1.6 Å

PDB Description: crystal structure of e. coli purk in complex with mgatp
PDB Compounds: (B:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOPe Domain Sequences for d3ethb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ethb2 c.30.1.1 (B:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}
mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
qlarhpafvnrdvfpiia

SCOPe Domain Coordinates for d3ethb2:

Click to download the PDB-style file with coordinates for d3ethb2.
(The format of our PDB-style files is described here.)

Timeline for d3ethb2: