Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins) |
Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 [56072] (1 species) |
Species Escherichia coli [TaxId:562] [56073] (4 PDB entries) |
Domain d3etha3: 3eth A:79-276 [158200] Other proteins in same PDB: d3etha1, d3etha2, d3ethb1, d3ethb2 automatically matched to d1b6ra3 complexed with atp, mg; mutant |
PDB Entry: 3eth (more details), 1.6 Å
SCOP Domain Sequences for d3etha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etha3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} drltqkqlfdklhlptapwqllaersewpavfdrlgelaivkrrtggydgrgqwrlrane teqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhqdgilrtsvafpqa naqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhnsghwtqngasisq felhlraitdlplpqpvv
Timeline for d3etha3: