Lineage for d1cnog_ (1cno G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 2303748Protein Cytochrome c552 [46636] (6 species)
  7. 2303801Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry)
  8. 2303808Domain d1cnog_: 1cno G: [15820]
    complexed with gol, hec

Details for d1cnog_

PDB Entry: 1cno (more details), 2.2 Å

PDB Description: structure of pseudomonas nautica cytochrome c552, by mad method
PDB Compounds: (G:) cytochrome c552

SCOPe Domain Sequences for d1cnog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnog_ a.3.1.1 (G:) Cytochrome c552 {Pseudomonas nautica [TaxId: 2743]}
agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
qgqatalsdadianlaayyasnpaaaa

SCOPe Domain Coordinates for d1cnog_:

Click to download the PDB-style file with coordinates for d1cnog_.
(The format of our PDB-style files is described here.)

Timeline for d1cnog_: