SCOP 1.75: Domain d3esra1: 3esr A:24-205

Lineage for d3esra1 (3esr A:24-205)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (25 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
   no insertion subdomains

6. Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species)

7. Species Escherichia coli [TaxId:562] [159535] (3 PDB entries)
   Uniprot P63228 4-185

8. Domain d3esra1: 3esr A:24-205 [158197]
   automatically matched to 2GMW A:24-205
   complexed with ca, po4, zn

Details for d3esra1

PDB Entry: 3esr, 1.95 Å

PDB Description: Crystal Structure of D,D-heptose1.7-bisphosphate phosphatase from E. coli in complex with calcium and phosphate

PDB Compounds: (A:) D,D-heptose 1,7-bisphosphate phosphatase

SCOP Domain Sequences for d3esra1:

Sequence; same for both SEQRES and ATOM records:

>d3esra1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}
svpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargkf
teaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsardy
lhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqai
kk

Timeline for d3esra1:

• d3esra1 is new in SCOP 1.75
  
• d3esra1 appears in SCOPe 2.01
  
• d3esra1 appears in the current release, SCOPe 2.08, called d3esra_