Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (25 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins) no insertion subdomains |
Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species) |
Species Escherichia coli [TaxId:562] [159535] (3 PDB entries) Uniprot P63228 4-185 |
Domain d3esra1: 3esr A:24-205 [158197] automatically matched to 2GMW A:24-205 complexed with ca, po4, zn |
PDB Entry: 3esr (more details), 1.95 Å
SCOP Domain Sequences for d3esra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3esra1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} svpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargkf teaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsardy lhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqai kk
Timeline for d3esra1: