![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.23: SVA-like [158896] (1 protein) Pfam PF05326 |
![]() | Protein Prolactin-inducible protein, PIP [158897] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158898] (1 PDB entry) Uniprot P12273 29-146 |
![]() | Domain d3es6b1: 3es6 B:1-118 [158195] formerly c2ICNB (obsolete) complexed with co3, p6g |
PDB Entry: 3es6 (more details), 3.23 Å
SCOPe Domain Sequences for d3es6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3es6b1 b.1.18.23 (B:1-118) Prolactin-inducible protein, PIP {Human (Homo sapiens) [TaxId: 9606]} qdntrkiiiknfdipksvrpndevtavlavqtelkecmvvktylissiplqgafnykyta clcddnpktfywdfytnrtvqiaavvdvirelgicpddaavipiknnrfytieilkve
Timeline for d3es6b1: