Lineage for d3es6b1 (3es6 B:1-118)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789693Family b.1.18.23: SVA-like [158896] (1 protein)
    Pfam PF05326
  6. 789694Protein Prolactin-inducible protein, PIP [158897] (1 species)
  7. 789695Species Human (Homo sapiens) [TaxId:9606] [158898] (1 PDB entry)
    Uniprot P12273 29-146
  8. 789696Domain d3es6b1: 3es6 B:1-118 [158195]
    formerly c2ICNB (obsolete)
    complexed with bma, co3, man, nag, ndg, p6g

Details for d3es6b1

PDB Entry: 3es6 (more details), 3.23 Å

PDB Description: crystal structure of the novel complex formed between zinc 2- glycoprotein (zag) and prolactin inducible protein (pip) from human seminal plasma
PDB Compounds: (B:) Prolactin-inducible protein

SCOP Domain Sequences for d3es6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3es6b1 b.1.18.23 (B:1-118) Prolactin-inducible protein, PIP {Human (Homo sapiens) [TaxId: 9606]}
qdntrkiiiknfdipksvrpndevtavlavqtelkecmvvktylissiplqgafnykyta
clcddnpktfywdfytnrtvqiaavvdvirelgicpddaavipiknnrfytieilkve

SCOP Domain Coordinates for d3es6b1:

Click to download the PDB-style file with coordinates for d3es6b1.
(The format of our PDB-style files is described here.)

Timeline for d3es6b1: