Lineage for d3erjb_ (3erj B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493970Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 2493971Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 2493972Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins)
    Pfam PF01981; UPF0099
  6. 2493987Protein automated matches [190394] (1 species)
    not a true protein
  7. 2493988Species Archaeoglobus fulgidus [TaxId:2234] [187261] (1 PDB entry)
  8. 2493990Domain d3erjb_: 3erj B: [158194]
    Other proteins in same PDB: d3erja3
    automated match to d1rzwa_

Details for d3erjb_

PDB Entry: 3erj (more details), 1.8 Å

PDB Description: crystal structure of the peptidyl-trna hydrolase af2095 from archaeglobus fulgidis. northeast structural genomics consortium target gr4
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d3erjb_:

Sequence, based on SEQRES records: (download)

>d3erjb_ c.131.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
tlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvksleel
lgikhkaeslglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpll

Sequence, based on observed residues (ATOM records): (download)

>d3erjb_ c.131.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
tlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvksleel
lgikhkaeslglvtglvqdagltevppgtitavvigpdeerkidkvtlpll

SCOPe Domain Coordinates for d3erjb_:

Click to download the PDB-style file with coordinates for d3erjb_.
(The format of our PDB-style files is described here.)

Timeline for d3erjb_: