Lineage for d3erja_ (3erj A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886045Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 1886046Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 1886047Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins)
    Pfam PF01981; UPF0099
  6. 1886062Protein automated matches [190394] (1 species)
    not a true protein
  7. 1886063Species Archaeoglobus fulgidus [TaxId:2234] [187261] (1 PDB entry)
  8. 1886064Domain d3erja_: 3erj A: [158193]
    automated match to d1rzwa_

Details for d3erja_

PDB Entry: 3erj (more details), 1.8 Å

PDB Description: crystal structure of the peptidyl-trna hydrolase af2095 from archaeglobus fulgidis. northeast structural genomics consortium target gr4
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d3erja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erja_ c.131.1.1 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
tlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvksleel
lgikhkaeslglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpllkle

SCOPe Domain Coordinates for d3erja_:

Click to download the PDB-style file with coordinates for d3erja_.
(The format of our PDB-style files is described here.)

Timeline for d3erja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3erjb_