SCOPe 2.05: Domain d3er7b_: 3er7 B:

Lineage for d3er7b_ (3er7 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.24: Exig0174-like [160021] (1 protein)
   PfamB PB092483
   automatically mapped to Pfam PF12680

6. Protein Uncharacterized protein Exig0174 [160022] (1 species)

7. Species Exiguobacterium sibiricum 255-15 [TaxId:262543] [160023] (1 PDB entry)
   Uniprot B1YHC8 5-122

8. Domain d3er7b_: 3er7 B: [158192]
   automated match to d3er7a1
   complexed with cl, peg

Details for d3er7b_

PDB Entry: 3er7, 1.5 Å

PDB Description: crystal structure of ntf2-like protein of unknown function (yp_001812677.1) from exiguobacterium sp. 255-15 at 1.50 a resolution

PDB Compounds: (B:) uncharacterized NTF2-like protein

SCOPe Domain Sequences for d3er7b_:

Sequence; same for both SEQRES and ATOM records:

>d3er7b_ d.17.4.24 (B:) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]}
ttldryfdlfdasrtdekafddlislfsdeitfvlngqeqhgidawkqfvrmvftanqdi
khmyagwvpsetgdtmetrwavcgksadgsvftqdgtdiarlnadgkivylanvpddtam
fnq

Timeline for d3er7b_:

• d3er7b_ first appeared in SCOP 1.75, called d3er7b1
  
• d3er7b_ appears in SCOPe 2.04
  
• d3er7b_ appears in SCOPe 2.06
  
• d3er7b_ appears in the current release, SCOPe 2.08