| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.24: Exig0174-like [160021] (1 protein) PfamB PB092483 automatically mapped to Pfam PF12680 |
| Protein Uncharacterized protein Exig0174 [160022] (1 species) |
| Species Exiguobacterium sibiricum 255-15 [TaxId:262543] [160023] (1 PDB entry) Uniprot B1YHC8 5-122 |
| Domain d3er7b_: 3er7 B: [158192] automated match to d3er7a1 complexed with cl, peg |
PDB Entry: 3er7 (more details), 1.5 Å
SCOPe Domain Sequences for d3er7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3er7b_ d.17.4.24 (B:) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]}
ttldryfdlfdasrtdekafddlislfsdeitfvlngqeqhgidawkqfvrmvftanqdi
khmyagwvpsetgdtmetrwavcgksadgsvftqdgtdiarlnadgkivylanvpddtam
fnq
Timeline for d3er7b_: