Lineage for d3er7b_ (3er7 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937094Family d.17.4.24: Exig0174-like [160021] (1 protein)
    PfamB PB092483
    automatically mapped to Pfam PF12680
  6. 2937095Protein Uncharacterized protein Exig0174 [160022] (1 species)
  7. 2937096Species Exiguobacterium sibiricum 255-15 [TaxId:262543] [160023] (1 PDB entry)
    Uniprot B1YHC8 5-122
  8. 2937098Domain d3er7b_: 3er7 B: [158192]
    automated match to d3er7a1
    complexed with cl, peg

Details for d3er7b_

PDB Entry: 3er7 (more details), 1.5 Å

PDB Description: crystal structure of ntf2-like protein of unknown function (yp_001812677.1) from exiguobacterium sp. 255-15 at 1.50 a resolution
PDB Compounds: (B:) uncharacterized NTF2-like protein

SCOPe Domain Sequences for d3er7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3er7b_ d.17.4.24 (B:) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]}
ttldryfdlfdasrtdekafddlislfsdeitfvlngqeqhgidawkqfvrmvftanqdi
khmyagwvpsetgdtmetrwavcgksadgsvftqdgtdiarlnadgkivylanvpddtam
fnq

SCOPe Domain Coordinates for d3er7b_:

Click to download the PDB-style file with coordinates for d3er7b_.
(The format of our PDB-style files is described here.)

Timeline for d3er7b_: