Lineage for d3enba1 (3enb A:1771-1989)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2140207Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins)
    automatically mapped to Pfam PF12134
  6. 2140208Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (3 species)
  7. 2140220Species Human (Homo sapiens) [TaxId:9606] [159640] (13 PDB entries)
    Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989
  8. 2140241Domain d3enba1: 3enb A:1771-1989 [158189]

Details for d3enba1

PDB Entry: 3enb (more details), 1.85 Å

PDB Description: crystal structure of prp8 core domain iv
PDB Compounds: (A:) Pre-mRNA-processing-splicing factor 8

SCOPe Domain Sequences for d3enba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3enba1 c.55.3.14 (A:1771-1989) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]}
lfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwagq
krlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselq
lpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndra
kvilkpdkttitephhiwptltdeewikvevqlkdlila

SCOPe Domain Coordinates for d3enba1:

Click to download the PDB-style file with coordinates for d3enba1.
(The format of our PDB-style files is described here.)

Timeline for d3enba1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3enbb_