SCOPe 2.01: Domain d3elna_: 3eln A:

Lineage for d3elna_ (3eln A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein Cysteine dioxygenase type I [141616] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (3 PDB entries)

8. Domain d3elna_: 3eln A: [158185]
   automated match to d2atfa1
   complexed with 2co, fe2

Details for d3elna_

PDB Entry: 3eln, 1.42 Å

PDB Description: a putative fe2+-bound persulfenate intermediate in cysteine dioxygenase

PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d3elna_:

Sequence; same for both SEQRES and ATOM records:

>d3elna_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlv
dqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikkser
tlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhs
kfgirtp

Timeline for d3elna_:

• d3elna_ first appeared in SCOP 1.75, called d3elna1
  
• d3elna_ appears in SCOPe 2.02
  
• d3elna_ appears in the current release, SCOPe 2.08