| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
Superfamily d.98.2: BT0923-like [160574] (2 families) ![]() Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices |
| Family d.98.2.1: BT0923-like [160575] (3 proteins) after putative calcium-regulated periplasmic protein BT0923 (PDB ID 3DUE; new) |
| Protein Putative periplasmic protein BVU2443 [160576] (1 species) |
| Species Bacteroides vulgatus [TaxId:821] [160577] (1 PDB entry) Uniprot A6L337 20-146 |
| Domain d3elgb_: 3elg B: [158183] automated match to d3elga1 complexed with cit |
PDB Entry: 3elg (more details), 1.64 Å
SCOPe Domain Sequences for d3elgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3elgb_ d.98.2.1 (B:) Putative periplasmic protein BVU2443 {Bacteroides vulgatus [TaxId: 821]}
gdvvtrdvnklpvaaremigkhfsqtkvayikiekdlfqttsydvkladgielefnskge
wleidcknksvpstfipqaiskymkanynghktvkiernrkgyeltlenglevdfdqfgg
flklsd
Timeline for d3elgb_: