Lineage for d3ejva1 (3ejv A:2-160)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937147Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins)
    PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA
  6. 2937155Protein Uncharacterized protein Saro2766 [160037] (1 species)
  7. 2937156Species Novosphingobium aromaticivorans [TaxId:48935] [160038] (1 PDB entry)
    Uniprot Q2G4M1 2-160
  8. 2937157Domain d3ejva1: 3ejv A:2-160 [158181]
    complexed with edo, pge, unl

Details for d3ejva1

PDB Entry: 3ejv (more details), 1.4 Å

PDB Description: crystal structure of a cystatin-like protein (saro_2766) from novosphingobium aromaticivorans dsm at 1.40 a resolution
PDB Compounds: (A:) uncharacterized protein with cystatin-like fold

SCOPe Domain Sequences for d3ejva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]}
tmadetiilnvlgqytrahdrrdpdamaalfapeatieivdavggasrsisrlegrdair
vavrqmmaphgyrawsqnvvnapiiviegdhavldaqfmvfsilaaevpdggwptgtfga
qgrivpieagqyrltlrtvadgwvisamriehrlpmafg

SCOPe Domain Coordinates for d3ejva1:

Click to download the PDB-style file with coordinates for d3ejva1.
(The format of our PDB-style files is described here.)

Timeline for d3ejva1: