SCOPe 2.08: Domain d3ejva1: 3ejv A:2-160

Lineage for d3ejva1 (3ejv A:2-160)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins)
   PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA

6. Protein Uncharacterized protein Saro2766 [160037] (1 species)

7. Species Novosphingobium aromaticivorans [TaxId:48935] [160038] (1 PDB entry)
   Uniprot Q2G4M1 2-160

8. Domain d3ejva1: 3ejv A:2-160 [158181]
   complexed with edo, pge, unl

Details for d3ejva1

PDB Entry: 3ejv, 1.4 Å

PDB Description: crystal structure of a cystatin-like protein (saro_2766) from novosphingobium aromaticivorans dsm at 1.40 a resolution

PDB Compounds: (A:) uncharacterized protein with cystatin-like fold

SCOPe Domain Sequences for d3ejva1:

Sequence; same for both SEQRES and ATOM records:

>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]}
tmadetiilnvlgqytrahdrrdpdamaalfapeatieivdavggasrsisrlegrdair
vavrqmmaphgyrawsqnvvnapiiviegdhavldaqfmvfsilaaevpdggwptgtfga
qgrivpieagqyrltlrtvadgwvisamriehrlpmafg

Timeline for d3ejva1:

• d3ejva1 first appeared in SCOP 1.75
  
• d3ejva1 appears in SCOPe 2.07