Lineage for d3ejna1 (3ejn A:32-490)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007546Family a.118.8.6: SusD-like [158775] (4 protein domains)
    TPR-like structure resides in the N-terminal part; the C-terminal part is structurally unique and is covered by Pfam PF07980
  6. 2007561Protein Uncharacterized protein BF3025 [158778] (1 species)
  7. 2007562Species Bacteroides fragilis [TaxId:817] [158779] (1 PDB entry)
    Uniprot Q5LB02 32-490
  8. 2007563Domain d3ejna1: 3ejn A:32-490 [158180]
    complexed with fmt, mg, pg4

Details for d3ejna1

PDB Entry: 3ejn (more details), 1.5 Å

PDB Description: crystal structure of a susd homolog (bf3025) from bacteroides fragilis nctc 9343 at 1.50 a resolution
PDB Compounds: (A:) SusD homolog

SCOPe Domain Sequences for d3ejna1:

Sequence, based on SEQRES records: (download)

>d3ejna1 a.118.8.6 (A:32-490) Uncharacterized protein BF3025 {Bacteroides fragilis [TaxId: 817]}
qthpkllltqicmnafkrgtdgmyatkkviqadgesadqyykwtrgsfgyydnlrnvqkm
geeaervnapvytaltkffrayyfyeltlrfgdipysqalkgekeeiytpeydaqedvfa
gilqelreadeilandasvidgdiiyngnstqwrklinsfrlkvlmtlsnhttvgninia
sefkniatnsplmnsladngqlvyldqqgnrypqfnaqwsgyymddtfiqrmrerrdprl
fifsaqtnkgktegkpiddfssyeggdpaapysdaiikvsegtispindrfrtdpivept
mlmgyaelqqilaeavvrgwisgnaqtyyekgirasfsfyethakdyagylnenavaqyl
keplvdftqasgteeqieriimqkylvtfyqgnwdsfyeqlrtgypdfrrpagteipkrw
mypqgeydnngtnvetaitrqfgagndkinqatwwqkks

Sequence, based on observed residues (ATOM records): (download)

>d3ejna1 a.118.8.6 (A:32-490) Uncharacterized protein BF3025 {Bacteroides fragilis [TaxId: 817]}
qthpkllltqicmnafkrgtdgmyatkkviqadgesadqyykwtrgsfgyydnlrnvqkm
geeaervnapvytaltkffrayyfyeltlrfgdipysqalkytpeydaqedvfagilqel
readeilandasvidgdiiyngnstqwrklinsfrlkvlmtlsnhttvgniniasefkni
atnsplmnsladngqlvyldqqgnrypqfnaqwsgyymddtfiqrmrerrdprlfifsaq
tnkgktegkpiddfssyeggdpaapysdaiikvsispindrfrtdpiveptmlmgyaelq
qilaeavvrgwisgnaqtyyekgirasfsfyethakdyagylnenavaqylkeplvdftq
asgteeqieriimqkylvtfyqgnwdsfyeqlrtgypdfrrpagteipkrwmypqgeydn
ngtnvetaitrqfgagndkinqatwwqkks

SCOPe Domain Coordinates for d3ejna1:

Click to download the PDB-style file with coordinates for d3ejna1.
(The format of our PDB-style files is described here.)

Timeline for d3ejna1: