Lineage for d1cnoe_ (1cno E:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 protein domains)
  6. 1028Protein Cytochrome c552 [46636] (5 species)
  7. 1044Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry)
  8. 1049Domain d1cnoe_: 1cno E: [15818]

Details for d1cnoe_

PDB Entry: 1cno (more details), 2.2 Å

PDB Description: structure of pseudomonas nautica cytochrome c552, by mad method

SCOP Domain Sequences for d1cnoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnoe_ a.3.1.1 (E:) Cytochrome c552 {Pseudomonas nautica}
agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
qgqatalsdadianlaayyasnpaaa

SCOP Domain Coordinates for d1cnoe_:

Click to download the PDB-style file with coordinates for d1cnoe_.
(The format of our PDB-style files is described here.)

Timeline for d1cnoe_: