![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c552 [46636] (6 species) |
![]() | Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry) |
![]() | Domain d1cnoe_: 1cno E: [15818] complexed with gol, hec |
PDB Entry: 1cno (more details), 2.2 Å
SCOPe Domain Sequences for d1cnoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnoe_ a.3.1.1 (E:) Cytochrome c552 {Pseudomonas nautica [TaxId: 2743]} agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm qgqatalsdadianlaayyasnpaaa
Timeline for d1cnoe_: