| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein Acyl carrier protein [47338] (7 species) |
| Species Escherichia coli [TaxId:562] [47339] (26 PDB entries) Uniprot P02901 |
| Domain d3ejdc2: 3ejd C:20-93 [158173] Other proteins in same PDB: d3ejda3, d3ejdb_, d3ejdc3, d3ejdd_, d3ejde3, d3ejdf_, d3ejdg3, d3ejdh_ automated match to d1t8ka_ complexed with cl, hem, htg, zmq |
PDB Entry: 3ejd (more details), 2.1 Å
SCOPe Domain Sequences for d3ejdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejdc2 a.28.1.1 (C:20-93) Acyl carrier protein {Escherichia coli [TaxId: 562]}
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidyin
Timeline for d3ejdc2: