Lineage for d3ejbg1 (3ejb G:21-93)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767347Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 767348Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 767349Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (6 proteins)
  6. 767354Protein Acyl carrier protein [47338] (4 species)
  7. 767360Species Escherichia coli [TaxId:562] [47339] (11 PDB entries)
    Uniprot P02901
  8. 767372Domain d3ejbg1: 3ejb G:21-93 [158171]
    automatically matched to d1acpa_
    complexed with cl, hem, htg, zmp

Details for d3ejbg1

PDB Entry: 3ejb (more details), 2 Å

PDB Description: crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein
PDB Compounds: (G:) Acyl carrier protein

SCOP Domain Sequences for d3ejbg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejbg1 a.28.1.1 (G:21-93) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyin

SCOP Domain Coordinates for d3ejbg1:

Click to download the PDB-style file with coordinates for d3ejbg1.
(The format of our PDB-style files is described here.)

Timeline for d3ejbg1: