| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Cytochrome c552 [46636] (6 species) |
| Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry) |
| Domain d1cnod_: 1cno D: [15817] complexed with gol, hec |
PDB Entry: 1cno (more details), 2.2 Å
SCOPe Domain Sequences for d1cnod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnod_ a.3.1.1 (D:) Cytochrome c552 {Pseudomonas nautica [TaxId: 2743]}
agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
qgqatalsdadianlaayyasnpaaa
Timeline for d1cnod_: