SCOPe 2.07: Domain d3ejba2: 3ejb A:20-95

Lineage for d3ejba2 (3ejb A:20-95)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 protein domains)

6. Protein Acyl carrier protein [47338] (7 species)

7. Species Escherichia coli [TaxId:562] [47339] (16 PDB entries)
   Uniprot P02901

8. Domain d3ejba2: 3ejb A:20-95 [158168]
   Other proteins in same PDB: d3ejba3, d3ejbb_, d3ejbc3, d3ejbd_, d3ejbe3, d3ejbf_, d3ejbg3, d3ejbh_
   automated match to d1t8ka_
   complexed with cl, hem, htg, zmp

Details for d3ejba2

PDB Entry: 3ejb, 2 Å

PDB Description: crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d3ejba2:

Sequence; same for both SEQRES and ATOM records:

>d3ejba2 a.28.1.1 (A:20-95) Acyl carrier protein {Escherichia coli [TaxId: 562]}
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidyingh

Timeline for d3ejba2:

• d3ejba2 first appeared in SCOP 1.75, called d3ejba1
  
• d3ejba2 appears in SCOPe 2.06