![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein Acyl carrier protein [47338] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [47339] (26 PDB entries) Uniprot P02901 |
![]() | Domain d3ejba2: 3ejb A:20-95 [158168] Other proteins in same PDB: d3ejba3, d3ejbb_, d3ejbc3, d3ejbd_, d3ejbe3, d3ejbf_, d3ejbg3, d3ejbh_ automated match to d1t8ka_ complexed with cl, hem, htg, zmp |
PDB Entry: 3ejb (more details), 2 Å
SCOPe Domain Sequences for d3ejba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejba2 a.28.1.1 (A:20-95) Acyl carrier protein {Escherichia coli [TaxId: 562]} mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea ekittvqaaidyingh
Timeline for d3ejba2: