Lineage for d3ejba2 (3ejb A:20-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706115Protein Acyl carrier protein [47338] (7 species)
  7. 2706121Species Escherichia coli [TaxId:562] [47339] (26 PDB entries)
    Uniprot P02901
  8. 2706134Domain d3ejba2: 3ejb A:20-95 [158168]
    Other proteins in same PDB: d3ejba3, d3ejbb_, d3ejbc3, d3ejbd_, d3ejbe3, d3ejbf_, d3ejbg3, d3ejbh_
    automated match to d1t8ka_
    complexed with cl, hem, htg, zmp

Details for d3ejba2

PDB Entry: 3ejb (more details), 2 Å

PDB Description: crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d3ejba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejba2 a.28.1.1 (A:20-95) Acyl carrier protein {Escherichia coli [TaxId: 562]}
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidyingh

SCOPe Domain Coordinates for d3ejba2:

Click to download the PDB-style file with coordinates for d3ejba2.
(The format of our PDB-style files is described here.)

Timeline for d3ejba2: