SCOPe 2.07: Domain d3ej1b2: 3ej1 B:309-432

Lineage for d3ej1b2 (3ej1 B:309-432)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 protein domains)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d3ej1b2: 3ej1 B:309-432 [158165]
   automatically matched to d1vina2
   complexed with 5bp

Details for d3ej1b2

PDB Entry: 3ej1, 3.22 Å

PDB Description: CDK2/CyclinA complexed with a pyrazolopyridazine inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3ej1b2:

Sequence; same for both SEQRES and ATOM records:

>d3ej1b2 a.74.1.1 (B:309-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

Timeline for d3ej1b2:

• d3ej1b2 first appeared in SCOP 1.75
  
• d3ej1b2 appears in SCOPe 2.06