SCOPe 2.05: Domain d3ej1b1: 3ej1 B:181-308

Lineage for d3ej1b1 (3ej1 B:181-308)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries)
   Uniprot P20248 175-432

8. Domain d3ej1b1: 3ej1 B:181-308 [158164]
   automatically matched to d1vina1
   complexed with 5bp

Details for d3ej1b1

PDB Entry: 3ej1, 3.22 Å

PDB Description: cdk2/cyclina complexed with a pyrazolopyridazine inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3ej1b1:

Sequence; same for both SEQRES and ATOM records:

>d3ej1b1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

Timeline for d3ej1b1:

• d3ej1b1 first appeared in SCOP 1.75
  
• d3ej1b1 appears in SCOPe 2.04
  
• d3ej1b1 appears in SCOPe 2.06
  
• d3ej1b1 appears in the current release, SCOPe 2.08