Lineage for d3eidb2 (3eid B:309-432)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772181Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 772182Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 772183Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 772194Protein Cyclin A [47956] (2 species)
  7. 772294Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
    Uniprot P20248 175-432
  8. 772398Domain d3eidb2: 3eid B:309-432 [158161]
    automatically matched to d1vina2
    complexed with po5

Details for d3eidb2

PDB Entry: 3eid (more details), 3.15 Å

PDB Description: cdk2/cyclina complexed with a pyrazolopyridazine inhibitor
PDB Compounds: (B:) Cyclin-A2

SCOP Domain Sequences for d3eidb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eidb2 a.74.1.1 (B:309-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOP Domain Coordinates for d3eidb2:

Click to download the PDB-style file with coordinates for d3eidb2.
(The format of our PDB-style files is described here.)

Timeline for d3eidb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eidb1