SCOPe 2.08: Domain d3eidb1: 3eid B:176-309

Lineage for d3eidb1 (3eid B:176-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d3eidb1: 3eid B:176-309 [158160]
   Other proteins in same PDB: d3eida_, d3eidc_
   automated match to d1finb1
   complexed with po5

Details for d3eidb1

PDB Entry: 3eid, 3.15 Å

PDB Description: cdk2/cyclina complexed with a pyrazolopyridazine inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3eidb1:

Sequence; same for both SEQRES and ATOM records:

>d3eidb1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

Timeline for d3eidb1:

• d3eidb1 first appeared in SCOP 1.75
  
• d3eidb1 appears in SCOPe 2.07