Lineage for d1cnoc_ (1cno C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690913Protein Cytochrome c552 [46636] (6 species)
  7. 2690966Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry)
  8. 2690969Domain d1cnoc_: 1cno C: [15816]
    complexed with gol, hec

Details for d1cnoc_

PDB Entry: 1cno (more details), 2.2 Å

PDB Description: structure of pseudomonas nautica cytochrome c552, by mad method
PDB Compounds: (C:) cytochrome c552

SCOPe Domain Sequences for d1cnoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnoc_ a.3.1.1 (C:) Cytochrome c552 {Pseudomonas nautica [TaxId: 2743]}
agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
qgqatalsdadianlaayyasnpaaa

SCOPe Domain Coordinates for d1cnoc_:

Click to download the PDB-style file with coordinates for d1cnoc_.
(The format of our PDB-style files is described here.)

Timeline for d1cnoc_: