SCOPe 2.03: Domain d3ehwz_: 3ehw Z:

Lineage for d3ehwz_ (3ehw Z:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226031] (4 PDB entries)

8. Domain d3ehwz_: 3ehw Z: [158159]
   automated match to d4apza_
   complexed with dup, mg

Details for d3ehwz_

PDB Entry: 3ehw, 1.8 Å

PDB Description: Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the full-length C-termini in all monomers and suggestion for an additional metal ion binding site

PDB Compounds: (Z:) dUTP pyrophosphatase

SCOPe Domain Sequences for d3ehwz_:

Sequence; same for both SEQRES and ATOM records:

>d3ehwz_ b.85.4.0 (Z:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrvap
rsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeiee
vqalddtergsggfgstgkn

Timeline for d3ehwz_:

• d3ehwz_ first appeared in SCOP 1.75, called d3ehwz1
  
• d3ehwz_ was called d3ehwz1 in SCOPe 2.02
  
• d3ehwz_ appears in SCOPe 2.04
  
• d3ehwz_ appears in the current release, SCOPe 2.08