Lineage for d3ehwb1 (3ehw B:25-159)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811150Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 811151Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 811183Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)
  7. 811217Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)
  8. 811219Domain d3ehwb1: 3ehw B:25-159 [158155]
    automatically matched to d1q5hc_
    complexed with dup, mg

Details for d3ehwb1

PDB Entry: 3ehw (more details), 1.8 Å

PDB Description: Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the full-length C-termini in all monomers and suggestion for an additional metal ion binding site
PDB Compounds: (B:) dUTP pyrophosphatase

SCOP Domain Sequences for d3ehwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehwb1 b.85.4.1 (B:25-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
qlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrvap
rsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeiee
vqalddtergsggfg

SCOP Domain Coordinates for d3ehwb1:

Click to download the PDB-style file with coordinates for d3ehwb1.
(The format of our PDB-style files is described here.)

Timeline for d3ehwb1: