SCOPe 2.01: Domain d3ehwa1: 3ehw A:24-159

Lineage for d3ehwa1 (3ehw A:24-159)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)

8. Domain d3ehwa1: 3ehw A:24-159 [158154]
   automatically matched to d1q5hc_
   complexed with dup, mg

Details for d3ehwa1

PDB Entry: 3ehw, 1.8 Å

PDB Description: Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the full-length C-termini in all monomers and suggestion for an additional metal ion binding site

PDB Compounds: (A:) dUTP pyrophosphatase

SCOPe Domain Sequences for d3ehwa1:

Sequence; same for both SEQRES and ATOM records:

>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggfg

Timeline for d3ehwa1:

• d3ehwa1 first appeared in SCOP 1.75
  
• d3ehwa1 appears in SCOPe 2.02
  
• d3ehwa1 appears in the current release, SCOPe 2.08, called d3ehwa_