Lineage for d3ehwa1 (3ehw A:24-159)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964543Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 964544Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 964595Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 964629Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)
  8. 964630Domain d3ehwa1: 3ehw A:24-159 [158154]
    automatically matched to d1q5hc_
    complexed with dup, mg

Details for d3ehwa1

PDB Entry: 3ehw (more details), 1.8 Å

PDB Description: Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the full-length C-termini in all monomers and suggestion for an additional metal ion binding site
PDB Compounds: (A:) dUTP pyrophosphatase

SCOPe Domain Sequences for d3ehwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggfg

SCOPe Domain Coordinates for d3ehwa1:

Click to download the PDB-style file with coordinates for d3ehwa1.
(The format of our PDB-style files is described here.)

Timeline for d3ehwa1: