Lineage for d3ehbc_ (3ehb C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356594Domain d3ehbc_: 3ehb C: [158152]
    Other proteins in same PDB: d3ehba_, d3ehbb1, d3ehbb2
    automated match to d1mqkh_
    complexed with ca, cu, hea, lda, lmt, mg, per; mutant

Details for d3ehbc_

PDB Entry: 3ehb (more details), 2.32 Å

PDB Description: a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate
PDB Compounds: (C:) FV fragment Chain H

SCOPe Domain Sequences for d3ehbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehbc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssa

SCOPe Domain Coordinates for d3ehbc_:

Click to download the PDB-style file with coordinates for d3ehbc_.
(The format of our PDB-style files is described here.)

Timeline for d3ehbc_: