SCOPe 2.07: Domain d3ehbb2: 3ehb B:1-107

Lineage for d3ehbb2 (3ehb B:1-107)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries)

8. Domain d3ehbb2: 3ehb B:1-107 [158151]
   Other proteins in same PDB: d3ehba_, d3ehbb1, d3ehbc_, d3ehbd_
   automated match to d1ar1b2
   complexed with ca, cu, hea, lda, lmt, mg, per; mutant

Details for d3ehbb2

PDB Entry: 3ehb, 2.32 Å

PDB Description: a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3ehbb2:

Sequence; same for both SEQRES and ATOM records:

>d3ehbb2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

Timeline for d3ehbb2:

• d3ehbb2 first appeared in SCOP 1.75
  
• d3ehbb2 appears in SCOPe 2.06
  
• d3ehbb2 appears in the current release, SCOPe 2.08