Lineage for d3ehbb2 (3ehb B:1-107)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2252897Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2252898Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2252899Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 2252900Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries)
  8. 2252901Domain d3ehbb2: 3ehb B:1-107 [158151]
    Other proteins in same PDB: d3ehba_, d3ehbb1, d3ehbc_, d3ehbd_
    automated match to d1ar1b2
    complexed with ca, cu, hea, lda, lmt, mg, per; mutant

Details for d3ehbb2

PDB Entry: 3ehb (more details), 2.32 Å

PDB Description: a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3ehbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehbb2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

SCOPe Domain Coordinates for d3ehbb2:

Click to download the PDB-style file with coordinates for d3ehbb2.
(The format of our PDB-style files is described here.)

Timeline for d3ehbb2: