SCOPe 2.07: Domain d3ehbb1: 3ehb B:108-253

Lineage for d3ehbb1 (3ehb B:108-253)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries)

8. Domain d3ehbb1: 3ehb B:108-253 [158150]
   Other proteins in same PDB: d3ehba_, d3ehbb2, d3ehbc_, d3ehbd_
   automated match to d1ar1b1
   complexed with ca, cu, hea, lda, lmt, mg, per; mutant

Details for d3ehbb1

PDB Entry: 3ehb, 2.32 Å

PDB Description: a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3ehbb1:

Sequence; same for both SEQRES and ATOM records:

>d3ehbb1 b.6.1.2 (B:108-253) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaad

Timeline for d3ehbb1:

• d3ehbb1 first appeared in SCOP 1.75
  
• d3ehbb1 appears in SCOPe 2.06
  
• d3ehbb1 appears in the current release, SCOPe 2.08