| Class b: All beta proteins [48724] (174 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
| Protein Cytochrome c oxidase [49544] (4 species) |
| Species Paracoccus denitrificans [TaxId:266] [49546] (3 PDB entries) |
| Domain d3ehbb1: 3ehb B:108-252 [158150] Other proteins in same PDB: d3ehba_, d3ehbb2, d3ehbc_, d3ehbd_ automatically matched to d1ar1b1 complexed with ca, cu, hea, lda, lmt, mg, per; mutant |
PDB Entry: 3ehb (more details), 2.32 Å
SCOPe Domain Sequences for d3ehbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ehbb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa
Timeline for d3ehbb1: