Lineage for d1cnob_ (1cno B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690913Protein Cytochrome c552 [46636] (6 species)
  7. 2690966Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry)
  8. 2690968Domain d1cnob_: 1cno B: [15815]
    complexed with gol, hec

Details for d1cnob_

PDB Entry: 1cno (more details), 2.2 Å

PDB Description: structure of pseudomonas nautica cytochrome c552, by mad method
PDB Compounds: (B:) cytochrome c552

SCOPe Domain Sequences for d1cnob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnob_ a.3.1.1 (B:) Cytochrome c552 {Pseudomonas nautica [TaxId: 2743]}
agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
qgqatalsdadianlaayyasnpaaa

SCOPe Domain Coordinates for d1cnob_:

Click to download the PDB-style file with coordinates for d1cnob_.
(The format of our PDB-style files is described here.)

Timeline for d1cnob_: