Lineage for d3efxm1 (3efx M:1-102)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 798737Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 798738Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 798813Domain d3efxm1: 3efx M:1-102 [158143]
    automatically matched to 3EFX D:1-102
    complexed with a2g, bgc, fuc, gal

Details for d3efxm1

PDB Entry: 3efx (more details), 1.94 Å

PDB Description: novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
PDB Compounds: (M:) Cholera enterotoxin subunit B, Heat-labile enterotoxin B chain

SCOP Domain Sequences for d3efxm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3efxm1 b.40.2.1 (M:1-102) Cholera toxin {Vibrio cholerae [TaxId: 666]}
apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

SCOP Domain Coordinates for d3efxm1:

Click to download the PDB-style file with coordinates for d3efxm1.
(The format of our PDB-style files is described here.)

Timeline for d3efxm1: