Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (11 species) not a true protein |
Species Vibrio cholerae [TaxId:37965] [187230] (2 PDB entries) |
Domain d3efxm_: 3efx M: [158143] Other proteins in same PDB: d3efxd1 automated match to d1eeid_ |
PDB Entry: 3efx (more details), 1.94 Å
SCOPe Domain Sequences for d3efxm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3efxm_ b.40.2.1 (M:) automated matches {Vibrio cholerae [TaxId: 37965]} apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma
Timeline for d3efxm_: