Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Cholera toxin [50208] (1 species) barrel, partly opened; n*=5, S*=10 |
Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries) Uniprot P01556 22-124 |
Domain d3efxj1: 3efx J:1-102 [158140] automatically matched to 3EFX D:1-102 complexed with a2g, bgc, fuc, gal |
PDB Entry: 3efx (more details), 1.94 Å
SCOP Domain Sequences for d3efxj1:
Sequence, based on SEQRES records: (download)
>d3efxj1 b.40.2.1 (J:1-102) Cholera toxin {Vibrio cholerae [TaxId: 666]} apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma
>d3efxj1 b.40.2.1 (J:1-102) Cholera toxin {Vibrio cholerae [TaxId: 666]} apqnitelcseyhntqiytindkilsyteslagremaiitfkngatfqvevqkkaiermk dtlriaylteakveklcvwnnktpnsiaaisma
Timeline for d3efxj1: