Lineage for d3efbc_ (3efb C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151216Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 protein domains)
    Pfam PF04198
  6. 2151241Protein automated matches [190970] (1 species)
    not a true protein
  7. 2151242Species Shigella flexneri 2a str. 2457T [TaxId:198215] [188611] (1 PDB entry)
  8. 2151244Domain d3efbc_: 3efb C: [158131]
    Other proteins in same PDB: d3efba1
    automated match to d3efba1
    complexed with acy

Details for d3efbc_

PDB Entry: 3efb (more details), 2 Å

PDB Description: Crystal Structure of Probable sor Operon Regulator from Shigella flexneri
PDB Compounds: (C:) Probable sor-operon regulator

SCOPe Domain Sequences for d3efbc_:

Sequence, based on SEQRES records: (download)

>d3efbc_ c.124.1.8 (C:) automated matches {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
enlwleqqlkqkfglkdvvvvsgndedeetqlammglhgaqlldrllepgdivgfswgra
vsalvenlpqagqsrqlicvpiiggpsgklesryhvntltysaaaklkgeshladfpall
dnplirngimqsqhfktisaywdnldialvgigspairdganwhafyggeesddlnarqv
agdicsrffdihgamvetnmsektlsiemnklkqarysigiamseekysgiigalrgkyi
nclvtnsstaelll

Sequence, based on observed residues (ATOM records): (download)

>d3efbc_ c.124.1.8 (C:) automated matches {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
enlwleqqlkqkfglkdvvvvsgndedeetqlammglhgaqlldrllepgdivgfswgra
vsalvenlpqagqsrqlicvpiiggpsgklesryhvntltysaaaklkgeshladfpall
dnplirngimqsqhfktisaywdnldialvgigsparqvagdicsrffdihgamvetnms
ektlsiemnklkqarysigiamseekysgiigalrgkyinclvtnsstaelll

SCOPe Domain Coordinates for d3efbc_:

Click to download the PDB-style file with coordinates for d3efbc_.
(The format of our PDB-style files is described here.)

Timeline for d3efbc_: