Lineage for d3efba1 (3efb A:11-265)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151216Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 protein domains)
    Pfam PF04198
  6. 2151229Protein Sor-operon regulator SorC [159552] (1 species)
  7. 2151230Species Shigella flexneri [TaxId:623] [159553] (1 PDB entry)
    Uniprot Q83PA8 61-315
  8. 2151231Domain d3efba1: 3efb A:11-265 [158129]
    Other proteins in same PDB: d3efbb_, d3efbc_, d3efbd_
    complexed with acy

Details for d3efba1

PDB Entry: 3efb (more details), 2 Å

PDB Description: Crystal Structure of Probable sor Operon Regulator from Shigella flexneri
PDB Compounds: (A:) Probable sor-operon regulator

SCOPe Domain Sequences for d3efba1:

Sequence, based on SEQRES records: (download)

>d3efba1 c.124.1.8 (A:11-265) Sor-operon regulator SorC {Shigella flexneri [TaxId: 623]}
enlwleqqlkqkfglkdvvvvsgndedeetqlammglhgaqlldrllepgdivgfswgra
vsalvenlpqagqsrqlicvpiiggpsgklesryhvntltysaaaklkgeshladfpall
dnplirngimqsqhfktisaywdnldialvgigspairdganwhafyggeesddlnarqv
agdicsrffdihgamvetnmsektlsiemnklkqarysigiamseekysgiigalrgkyi
nclvtnsstaelllk

Sequence, based on observed residues (ATOM records): (download)

>d3efba1 c.124.1.8 (A:11-265) Sor-operon regulator SorC {Shigella flexneri [TaxId: 623]}
enlwleqqlkqkfglkdvvvvsgndedeetqlammglhgaqlldrllepgdivgfswgra
vsalvenlpqagqsrqlicvpiiggpsgklesryhvntltysaaaklkgeshladfpall
dnplirngimqsqhfktisaywdnldialvgigspafyggeesddlnarqvagdicsrff
dihgamvetnmsektlsiemnklkqarysigiamseekysgiigalrgkyinclvtnsst
aelllk

SCOPe Domain Coordinates for d3efba1:

Click to download the PDB-style file with coordinates for d3efba1.
(The format of our PDB-style files is described here.)

Timeline for d3efba1: