SCOPe 2.06: Domain d3ef8a1: 3ef8 A:1-149

Lineage for d3ef8a1 (3ef8 A:1-149)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins)
   PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA

6. Protein Uncharacterized protein Saro1465 [160041] (1 species)

7. Species Novosphingobium aromaticivorans [TaxId:48935] [160042] (1 PDB entry)
   Uniprot Q2G8B5 1-149

8. Domain d3ef8a1: 3ef8 A:1-149 [158127]
   complexed with mg, peg, pg4, pge

Details for d3ef8a1

PDB Entry: 3ef8, 1.5 Å

PDB Description: crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution

PDB Compounds: (A:) Putative Scyalone Dehydratase

SCOPe Domain Sequences for d3ef8a1:

Sequence; same for both SEQRES and ATOM records:

>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]}
mtdtnlvemraiermmfdysyhldmnhpeelaalfvedcevsyapnfgatgrdaykktle
gigtffrgtshhnsnicidfvseteanvrsvvlaihrytkerpdgilygqyfdtvvkvdg
qwkfkrrelrttmttdyhvraanpigrae

Timeline for d3ef8a1:

• d3ef8a1 first appeared in SCOP 1.75
  
• d3ef8a1 appears in SCOPe 2.05
  
• d3ef8a1 appears in SCOPe 2.07
  
• d3ef8a1 appears in the current release, SCOPe 2.08