Lineage for d3ef8a1 (3ef8 A:1-149)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896907Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins)
    PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA
  6. 1896911Protein Uncharacterized protein Saro1465 [160041] (1 species)
  7. 1896912Species Novosphingobium aromaticivorans [TaxId:48935] [160042] (1 PDB entry)
    Uniprot Q2G8B5 1-149
  8. 1896913Domain d3ef8a1: 3ef8 A:1-149 [158127]
    complexed with mg, peg, pg4, pge

Details for d3ef8a1

PDB Entry: 3ef8 (more details), 1.5 Å

PDB Description: crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution
PDB Compounds: (A:) Putative Scyalone Dehydratase

SCOPe Domain Sequences for d3ef8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]}
mtdtnlvemraiermmfdysyhldmnhpeelaalfvedcevsyapnfgatgrdaykktle
gigtffrgtshhnsnicidfvseteanvrsvvlaihrytkerpdgilygqyfdtvvkvdg
qwkfkrrelrttmttdyhvraanpigrae

SCOPe Domain Coordinates for d3ef8a1:

Click to download the PDB-style file with coordinates for d3ef8a1.
(The format of our PDB-style files is described here.)

Timeline for d3ef8a1: