Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins) PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA |
Protein Uncharacterized protein Saro1465 [160041] (1 species) |
Species Novosphingobium aromaticivorans [TaxId:48935] [160042] (1 PDB entry) Uniprot Q2G8B5 1-149 |
Domain d3ef8a1: 3ef8 A:1-149 [158127] complexed with mg, peg, pg4, pge |
PDB Entry: 3ef8 (more details), 1.5 Å
SCOPe Domain Sequences for d3ef8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} mtdtnlvemraiermmfdysyhldmnhpeelaalfvedcevsyapnfgatgrdaykktle gigtffrgtshhnsnicidfvseteanvrsvvlaihrytkerpdgilygqyfdtvvkvdg qwkfkrrelrttmttdyhvraanpigrae
Timeline for d3ef8a1: