Lineage for d3eeqb1 (3eeq B:215-336)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152154Fold c.151: CobE/GbiG C-terminal domain-like [159663] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32154; strand 5 is antiparallel to the rest
  4. 2152155Superfamily c.151.1: CobE/GbiG C-terminal domain-like [159664] (1 family) (S)
    probably involved in deacylation steps in both anaerobic and aerobic pathways of cobalamin biosynthesis
    automatically mapped to Pfam PF01890
  5. 2152156Family c.151.1.1: CobE/GbiG C-terminal domain-like [159665] (3 protein domains)
    C-terminal part of Pfam PF01890 (CbiG); corresponds to standalone protein CobE in the aerobic pathway; also includes resent structure 3BY5
  6. 2152163Protein Cobalamin biosynthesis protein G, CbiG [159669] (1 species)
  7. 2152164Species Sulfolobus solfataricus [TaxId:2287] [159670] (1 PDB entry)
    Uniprot Q97WD0 215-335
  8. 2152166Domain d3eeqb1: 3eeq B:215-336 [158125]
    Other proteins in same PDB: d3eeqa2, d3eeqa3, d3eeqb2, d3eeqb3, d3eeqb4
    automated match to d3eeqa1
    complexed with so4

Details for d3eeqb1

PDB Entry: 3eeq (more details), 2.3 Å

PDB Description: crystal structure of a putative cobalamin biosynthesis protein g homolog from sulfolobus solfataricus
PDB Compounds: (B:) putative Cobalamin biosynthesis protein G homolog

SCOPe Domain Sequences for d3eeqb1:

Sequence, based on SEQRES records: (download)

>d3eeqb1 c.151.1.1 (B:215-336) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]}
kisigigskkdvkmeeirdgiykvlerlnlkrerigiiasireevkkiadefnvrfrlvn
eeeinnfmnpcltppsktlievglkgvaeisaliaggrnsklilrkiaisrnstiavaty
eg

Sequence, based on observed residues (ATOM records): (download)

>d3eeqb1 c.151.1.1 (B:215-336) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]}
kisigigskkdvkmeeirdgiykvlerlnlkrerigiiasireevkkiadefnvrfrlvn
eeeinnfmnpcltppkgvaeisaliaggrnsklilrkiaisrnstiavatyeg

SCOPe Domain Coordinates for d3eeqb1:

Click to download the PDB-style file with coordinates for d3eeqb1.
(The format of our PDB-style files is described here.)

Timeline for d3eeqb1: