Lineage for d3eeqa2 (3eeq A:10-214)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152170Fold c.152: CbiG N-terminal domain-like [159671] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 213456, strand 5 is antiparallel to the rest
  4. 2152171Superfamily c.152.1: CbiG N-terminal domain-like [159672] (1 family) (S)
    probable biological unit is a homodimer; putative active site is formed by residues from both subunits
  5. 2152172Family c.152.1.1: CbiG N-terminal domain-like [159673] (1 protein)
    N-terminal part of Pfam PF01890; also includes variable linker domain to CobE-like C-terminal domain; the linker domain may be in a rudimentary form or missing
  6. 2152173Protein Cobalamin biosynthesis protein G, CbiG [159674] (1 species)
  7. 2152174Species Sulfolobus solfataricus [TaxId:2287] [159675] (1 PDB entry)
    Uniprot Q97WD0 8-215
  8. 2152175Domain d3eeqa2: 3eeq A:10-214 [158124]
    Other proteins in same PDB: d3eeqa1, d3eeqa3, d3eeqb1, d3eeqb3, d3eeqb4
    complexed with so4

Details for d3eeqa2

PDB Entry: 3eeq (more details), 2.3 Å

PDB Description: crystal structure of a putative cobalamin biosynthesis protein g homolog from sulfolobus solfataricus
PDB Compounds: (A:) putative Cobalamin biosynthesis protein G homolog

SCOPe Domain Sequences for d3eeqa2:

Sequence, based on SEQRES records: (download)

>d3eeqa2 c.152.1.1 (A:10-214) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]}
ienlwrgiciisasedafsagetikeklksfeipvvhyrykdaeietiwkcydaivfvma
legatrivckyaksktedpaivciddkinyvipllgghwgandiarelsvilnstpiitt
aaeikgklsierianiliakiinpenivkinaallrdesicidgidvnvnfpenikvnse
ecsyiislrgdkeykdkivvwlkpl

Sequence, based on observed residues (ATOM records): (download)

>d3eeqa2 c.152.1.1 (A:10-214) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]}
ienlwrgiciisasedafsagetikeklksfeipvvhyrykdaeietiwkcydaivfvma
legatrivckyaksktedpaivciddkinyvipllgghwgandiarelsvilnstpiitk
lsierianiliakiinpenivkinaallrdesicidgidvnvnfpenikvcsyiislrgd
keykdkivvwlkpl

SCOPe Domain Coordinates for d3eeqa2:

Click to download the PDB-style file with coordinates for d3eeqa2.
(The format of our PDB-style files is described here.)

Timeline for d3eeqa2: