SCOPe 2.05: Domain d3eeqa1: 3eeq A:215-335

Lineage for d3eeqa1 (3eeq A:215-335)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.151: CobE/GbiG C-terminal domain-like [159663] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32154; strand 5 is antiparallel to the rest

4. Superfamily c.151.1: CobE/GbiG C-terminal domain-like [159664] (1 family)
   probably involved in deacylation steps in both anaerobic and aerobic pathways of cobalamin biosynthesis
   automatically mapped to Pfam PF01890

5. Family c.151.1.1: CobE/GbiG C-terminal domain-like [159665] (3 proteins)
   C-terminal part of Pfam PF01890 (CbiG); corresponds to standalone protein CobE in the aerobic pathway; also includes resent structure 3BY5

6. Protein Cobalamin biosynthesis protein G, CbiG [159669] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [159670] (1 PDB entry)
   Uniprot Q97WD0 215-335

8. Domain d3eeqa1: 3eeq A:215-335 [158123]
   Other proteins in same PDB: d3eeqa2, d3eeqb2
   complexed with so4

Details for d3eeqa1

PDB Entry: 3eeq, 2.3 Å

PDB Description: crystal structure of a putative cobalamin biosynthesis protein g homolog from sulfolobus solfataricus

PDB Compounds: (A:) putative Cobalamin biosynthesis protein G homolog

SCOPe Domain Sequences for d3eeqa1:

Sequence, based on SEQRES records:

>d3eeqa1 c.151.1.1 (A:215-335) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]}
kisigigskkdvkmeeirdgiykvlerlnlkrerigiiasireevkkiadefnvrfrlvn
eeeinnfmnpcltppsktlievglkgvaeisaliaggrnsklilrkiaisrnstiavaty
e

Sequence, based on observed residues (ATOM records):

>d3eeqa1 c.151.1.1 (A:215-335) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]}
kisigigskkdvkmeeirdgiykvlerlnlkrerigiiasireevkkiadefnvrfrlvn
eeeinnfmnpcltppsktkgvaeisaliaggrnsklilrkiaisrnstiavatye

Timeline for d3eeqa1:

• d3eeqa1 first appeared in SCOP 1.75
  
• d3eeqa1 appears in SCOPe 2.04
  
• d3eeqa1 appears in SCOPe 2.06
  
• d3eeqa1 appears in the current release, SCOPe 2.08