Lineage for d3eeda1 (3eed A:6-193)
- Root: SCOPe 2.03
Class g: Small proteins [56992] (90 folds) 
Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) 
automatically mapped to Pfam PF01214Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
contains alpha-helices in the N- and C-terminal extensions (linkers?)Protein Casein kinase II beta subunit [57800] (3 species) Species Human (Homo sapiens) [TaxId:9606] [57801] (3 PDB entries) 
Domain d3eeda1: 3eed A:6-193 [158121]
automatically matched to d1jwhd_
complexed with so4, zn; mutant
Details for d3eeda1
PDB Entry: 3eed (more details), 2.8 Å
PDB Description: Crystal structure of human protein kinase CK2 regulatory subunit (CK2beta; mutant 1-193)
PDB Compounds: (A:) Casein kinase II subunit betaSCOPe Domain Sequences for d3eeda1:
Sequence, based on SEQRES records: (download)
>d3eeda1 g.41.4.1 (A:6-193) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn
pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls
dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvp
rlygfkih
Sequence, based on observed residues (ATOM records): (download)
>d3eeda1 g.41.4.1 (A:6-193) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdnpnqsd
lieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipge
amvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygf
kih
SCOPe Domain Coordinates for d3eeda1:
Click to download the PDB-style file with coordinates for d3eeda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3eeda1:
- d3eeda1 first appeared in SCOP 1.75
- d3eeda1 appears in SCOPe 2.02
- d3eeda1 is called d3eeda_ in SCOPe 2.04
- d3eeda1 appears in the current release, SCOPe 2.08, called d3eeda_
View in 3D
