Lineage for d1foca_ (1foc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303748Protein Cytochrome c552 [46636] (6 species)
  7. 2303810Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries)
    Uniprot P04164
  8. 2303816Domain d1foca_: 1foc A: [15812]
    Cytochrome c557: improperly folded c552
    complexed with hem

Details for d1foca_

PDB Entry: 1foc (more details), 3 Å

PDB Description: cytochrome c557: improperly folded thermus thermophilus c552
PDB Compounds: (A:) cytochrome rc557

SCOPe Domain Sequences for d1foca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foca_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
gakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkgm
kyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvla
erkklglk

SCOPe Domain Coordinates for d1foca_:

Click to download the PDB-style file with coordinates for d1foca_.
(The format of our PDB-style files is described here.)

Timeline for d1foca_: