SCOPe 2.07: Domain d3ee2a1: 3ee2 A:76-199

Lineage for d3ee2a1 (3ee2 A:76-199)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (15 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d3ee2a1: 3ee2 A:76-199 [158117]
   Other proteins in same PDB: d3ee2a2, d3ee2b2
   automated match to d1pd211
   complexed with gsh, mg, nzo

Details for d3ee2a1

PDB Entry: 3ee2, 1.91 Å

PDB Description: structure of human prostaglandin d-synthase (hgsts1-1) in complex with nocodazole

PDB Compounds: (A:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d3ee2a1:

Sequence; same for both SEQRES and ATOM records:

>d3ee2a1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipaianwikrrp
qtkl

Timeline for d3ee2a1:

• d3ee2a1 first appeared in SCOP 1.75
  
• d3ee2a1 appears in SCOPe 2.06
  
• d3ee2a1 appears in the current release, SCOPe 2.08