![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species) |
![]() | Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries) |
![]() | Domain d3eckd2: 3eck D:148-322 [158115] automatically matched to d1f1xa2 complexed with ca, cl, fe2, gol, xxg |
PDB Entry: 3eck (more details), 1.6 Å
SCOPe Domain Sequences for d3eckd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eckd2 d.32.1.3 (D:148-322) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]} gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeii
Timeline for d3eckd2: